PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc03677.1.g00160.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 224aa    MW: 25423.8 Da    PI: 9.5401
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc03677.1.g00160.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding26.21.8e-081457344
                                  SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHH CS
               Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrw 44
                                  +W++ Ed+ +  a ++++ +   +W+ Ia+ ++ gRt+ ++ +++
  Zmw_sc03677.1.g00160.1.sm.mk 14 PWSKAEDKVFETALALWPDDtpeRWTMIAAQLP-GRTPQEVSEHY 57
                                  8*****************99*************.*******9998 PP

2Myb_DNA-binding27.28.8e-091672031147
                                   HHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
               Myb_DNA-binding  11 llvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                   l++++ +++G+g+W++I+r     Rt+ q+ s+ qky
  Zmw_sc03677.1.g00160.1.sm.mk 167 LFLQGLEKYGPGDWRSISRFAVRSRTPTQVASHAQKY 203
                                   89**********************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512948.308765IPR017930Myb domain
SuperFamilySSF466894.81E-111059IPR009057Homeodomain-like
SMARTSM007173.4E-81163IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.9E-71358IPR009057Homeodomain-like
CDDcd001675.32E-71457No hitNo description
PfamPF002491.1E-61457IPR001005SANT/Myb domain
PROSITE profilePS512948.121148208IPR017930Myb domain
SMARTSM007170.25165206IPR001005SANT/Myb domain
TIGRFAMsTIGR015572.4E-10166206IPR006447Myb domain, plants
CDDcd001674.40E-6166204No hitNo description
SuperFamilySSF466891.0E-9166206IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.7E-7167208IPR009057Homeodomain-like
PfamPF002491.1E-6167203IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 224 aa     Download sequence    Send to blast
MESHDDTPPP AGRPWSKAED KVFETALALW PDDTPERWTM IAAQLPGRTP QEVSEHYDAL  60
VADIELIESG AVEVPACWDA DNDGGSEESG ARGRRAGSGR GLPWSEEEHR YRASSSILRS  120
PIMRINWERT VAICLASRTS RPACLFVHKN LRRRVPRFLT PCVVCRLFLQ GLEKYGPGDW  180
RSISRFAVRS RTPTQVASHA QKYFKRHLNP RRSKRKSIYD ITTP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A2e-191175771RADIALIS
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002456680.19e-62hypothetical protein SORBIDRAFT_03g040730
TrEMBLC5XQK51e-61C5XQK5_SORBI; Putative uncharacterized protein Sb03g040730
STRINGSb03g040730.13e-61(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28953687